- Recombinant Saccharomyces cerevisiae UPF0495 protein YPR010C-A (YPR010C-A)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1241129
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,902 Da
- E Coli or Yeast
- 26299
- UPF0495 protein YPR010C-A (YPR010C-A)
Sequence
MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDETLRLTGNPELSSLDEVLAKDKD